PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04045.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 366aa    MW: 39438.6 Da    PI: 9.1473
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04045.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32.1e-1480127148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g W++eEd++l d + ++G  +W++ +++ g+ R +k+c++rw++yl
  Zmw_sc04045.1.g00030.1.am.mk  80 KGLWSPEEDQKLRDFIIRYGHSCWSALPAKAGLQRNGKSCRLRWLNYL 127
                                   678*******************************************97 PP

2Myb_DNA-binding47.34.6e-15134206248
                                   SSS-HHHHHHHHHHHHHTTTT...........................-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGgg...........................tWktIartmgkgRtlkqcksrwqkyl 48 
                                   g ++ eE+e   +++++lG++                           +W+ Iar+++ gRt++++k++w++yl
  Zmw_sc04045.1.g00030.1.am.mk 134 GMFSREEEEAVMNLHAKLGNKkdqrfssrlaalrmrhvfslrrvdsytRWSHIARHLP-GRTDNEVKNYWNSYL 206
                                   56999*****************************************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.81575131IPR017930Myb domain
SMARTSM007175.7E-1179129IPR001005SANT/Myb domain
SuperFamilySSF466894.03E-2280131IPR009057Homeodomain-like
PfamPF002499.3E-1380127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2081133IPR009057Homeodomain-like
CDDcd001673.63E-1083127No hitNo description
SMARTSM007178.2E-12132208IPR001005SANT/Myb domain
PROSITE profilePS5129410.717132210IPR017930Myb domain
PfamPF002493.5E-12134206IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-21134209IPR009057Homeodomain-like
CDDcd001672.88E-9136206No hitNo description
SuperFamilySSF466894.03E-22178207IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MATAPIKVLR AANPLRPHAN ADRHHSRAPQ VSSSPLRLHA ASSASFFSPC PALLRDISPP  60
PINQSMGCKA CQKPKVQYRK GLWSPEEDQK LRDFIIRYGH SCWSALPAKA GLQRNGKSCR  120
LRWLNYLRPG LKHGMFSREE EEAVMNLHAK LGNKKDQRFS SRLAALRMRH VFSLRRVDSY  180
TRWSHIARHL PGRTDNEVKN YWNSYLKKRV EGAQASKCAA DSDVGGSPNP SEQTSQGSLN  240
RPASSASSPV VESSSADNSS CLTVTEPAGG AAAAVRPHAP VLPKVMFADW FDMDYGVAPG  300
LDAGVFDVVN GSSPGLGSVQ VDGPCGAVGL DDGGVCWGFD AAAGQMDVQG GGFCDLLSVS  360
EFLGIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-22802117109B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976342.11e-147PREDICTED: transcription factor LAF1-like
TrEMBLK3YDJ91e-147K3YDJ9_SETIT; Uncharacterized protein
STRINGSi012304m1e-146(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109